Anti-Mouse MYT1L (KIAA1106) Polyclonal Antibody, Rabbit

Product#: FNK-MKA1106AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse MYT1L (KIAA1106) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKA1106AF
Quantity :50 µg (250 µL)
Gene :mouse myelin transcription factor 1-like (MYT1L) (mMYT1L, mKIAA1106)
Immunogen :GX0194 (GST-fusion protein, 154 amino acids)
    RATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLR
    TQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHMDPINEQNFD
    AYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0194. This antibody detects mMYT1L protein.  
    Other species have not been tested.
Long Term Storage :-20°C or below 
Shipping Condition  :Dry Ice 
 

Antigen Characterization 

  • Type: Primary
  • Application: Western Blot (WB),Enzyme-Linked Immunosorbent Assay (ELISA),Immunoprecipitation (IP),Immunofluorescence (IF)
  • Species: Human
  • Recombinant: Yes


Human Diseases

  • Intellectual Disability: Mutations in MYT1L have been linked to developmental disorders, including intellectual disability and autism spectrum disorder.
  • Schizophrenia and Depression: MYT1L expression has been associated with these psychiatric conditions, suggesting its role in brain development and function.
  • Obesity and ADHD: Animal models show phenotypes resembling these disorders due to MYT1L mutations.


Cellular Signaling Pathways

  • Neuronal Differentiation: MYT1L is crucial for promoting the differentiation of oligodendrocyte precursor cells (OPCs), which are essential for myelination in the central nervous system.
  • Transcriptional Regulation: It interacts with other transcription factors like Brn2 and Ascl1 to regulate neuronal identity and differentiation pathways.
  • Chromatin Remodeling: MYT1L recruits histone deacetylases, influencing gene expression related to neuronal fate.


Aliases for MYTL1 Gene

  • Myelin Transcription Factor 1 Like 2 3 5
  • Myelin Transcription Factor 1-Like Protein 3 4
  • Neural Zinc Finger Transcription Factor 1 2 3
  • KIAA1106 2 4
  • ZC2H2C2 2 3
  • ZC2HC4B 2 3
  • MyT1-L 3 4
  • NZF1 2 3
  • MRD39 3
  • MYT1L 5
  • MyT1L 4


References 

  • Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
  • 25234-1-AP.” MYT1L Antibody (25234-1-AP) | Proteintech, 31 Aug. 2024, www.ptglab.com/products/MYT1L-Antibody-25234-1-AP.htm. 
  • Shi, Yanqing, et al. “Myt1L Promotes Differentiation of Oligodendrocyte Precursor Cells and Is Necessary for Remyelination after Lysolecithin-Induced Demyelination.” Neuroscience Bulletin, U.S. National Library of Medicine, Apr. 2018, www.ncbi.nlm.nih.gov/pmc/articles/PMC5856724/. 
  • Chen, Jiayang, et al. “A MYT1L Syndrome Mouse Model Recapitulates Patient Phenotypes and Reveals Altered Brain Development Due to Disrupted Neuronal Maturation.” Neuron, U.S. National Library of Medicine, 1 Dec. 2021, www.ncbi.nlm.nih.gov/pmc/articles/PMC8668036/. 
  • Account - Genecards Suite, www.genecards.org/cgi-bin/carddisp.pl?gene=MYT1L. 
  • MYT1L Myelin Transcription Factor 1 like [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=23040.

Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X