Anti-Mouse MAP7D1 (KIAA1187) Polyclonal Antibody, Rabbit

Product#: FNK-MK11870910

$495.39

Qty:

Availability:

Ships in 1-2 Weeks

Anti-Mouse MAP7D1 (KIAA1187) Polyclonal Antibody, Rabbit

General information

Cat. No.	：FNK-MK11870910
Quantity	：50 µg (250 µL)
Gene	：mouse Microtubule-associated protein 7 domain containing 1 (mMAP7D1, mKIAA1187)
Immunogen	：GX0479 (GST-fusion protein, 179 amino acids) PTAAPSVTPSKPMAGTTDREEATRLLAEKRRQAREQREREEQERKLQAERDKRMREEQLARE AEARAEREAEARRREEQEAREKAQAEQEEQERLQKQKEEAEARSREEAERQRQEREKHFQK EEQERQERRKRLEEIMKRTRKSEAAETKVRILRLGSGSWGEERRLQRSLQSRGRIQ
Format	：Affinity Purified Rabbit IgG
Constitution	：PBS containing with 50% glycerol and 0.02% of NaN₃
Antigen Species	：Mouse
Host Species	：Rabbit
Label	：Unlabeled
Cross Reactivity	：Human/ Mouse
Application	：Western blotting (1 : 1,000), Other applications have not been tested.
Specificity	：Specific to recombinant protein GX0479. This antibody detects mMAP7D1 protein. It also recognizes human MAP7D1 protein. Details are shown in the InGaP database. Other species have not been tested.
Long Term Storage	：-20°C or below
Shipping Condition	：Dry Ice

Antigen Characterization

Type: Primary
Application: Western Blot: Used to detect MAP7D1 protein levels in various samples,ELISA: Employed for quantifying MAP7D1 in biological fluids,Immunoprecipitation: Helps in isolating MAP7D1 for further analysis.
Species: Human
Recombinant: Yes

Human Diseases

Cancer: Altered expression of MAP7D1 has been implicated in various cancers, potentially affecting tumor progression and response to therapy.
Neurodegenerative Disorders: Involvement in neuronal signaling pathways suggests a role in diseases like Alzheimer's.
Genetic Disorders: Mutations or dysregulation of MAP7D1 may contribute to specific genetic conditions affecting cellular processes.

Cellular Signaling Pathways

DNA Damage Response (DDR): MAP7D1 interacts with key proteins like RAD50 and BRCA1, playing a crucial role in the repair of DNA double-strand breaks and cell cycle regulation.
Microtubule Dynamics: As a microtubule-associated protein, MAP7D1 is involved in cellular transport and structural integrity, influencing signaling pathways related to cell migration and division.
Phosphorylation Events: MAP7D1's function is regulated through phosphorylation, impacting its interactions with other proteins during stress responses.

Aliases for MAP7D1 Gene

References

Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Dullovi, Arlinda, et al. “Microtubule-Associated Proteins MAP7 and MAP7D1 Promote DNA Double-Strand Break Repair in the G1 Cell Cycle Phase.” iScience, U.S. National Library of Medicine, 1 Feb. 2023, www.ncbi.nlm.nih.gov/pmc/articles/PMC9958362/.
MAP7D1 Protein Expression Summary - the Human Protein Atlas, www.proteinatlas.org/ENSG00000116871-MAP7D1.
MAP7D1 MAP7 Domain Containing 1 [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=55700.
Anti-MAP7D1 Antibody.” Www.Atlasantibodies.Com, www.atlasantibodies.com/products/primary-antibodies/triple-a-polyclonals/anti-map7d1-antibody-hpa028075/.
Account - Genecards Suite, www.genecards.org/cgi-bin/carddisp.pl?gene=MAP7D1.