Anti-Mouse MAP7D1 (KIAA1187) Polyclonal Antibody, Rabbit

Product#: MK11870910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse MAP7D1 (KIAA1187) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK11870910
Quantity 50 µg (250 µL)
Gene :mouse Microtubule-associated protein 7 domain containing 1 (mMAP7D1, mKIAA1187)
Immunogen GX0479 (GST-fusion protein, 179 amino acids)
    PTAAPSVTPSKPMAGTTDREEATRLLAEKRRQAREQREREEQERKLQAERDKRMREEQLARE
    AEARAEREAEARRREEQEAREKAQAEQEEQERLQKQKEEAEARSREEAERQRQEREKHFQK
    EEQERQERRKRLEEIMKRTRKSEAAETKVRILRLGSGSWGEERRLQRSLQSRGRIQ
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0479. This antibody detects mMAP7D1 protein. It also recognizes
    human MAP7D1 protein. Details are shown in the InGaP database. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for MAP7D1 Gene

  • MAP7 Domain Containing 1 2 3 5
  • Arginine/Proline-Rich Coiled-Coil Domain-Containing Protein 1 3 4
  • Proline/Arginine-Rich Coiled-Coil Domain-Containing Protein 1 3 4
  • Proline Arginine Rich Coiled Coil 1 2 3
  • Arginine/Proline Rich Coiled-Coil 1 2 3
  • MAP7 Domain-Containing Protein 1 3 4
  • PARCC1 3 4
  • RPRC1 3 4
  • FLJ10350 2
  • FLJ39022 2
  • KIAA1187 4
  • MAP7D1 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X