Anti-Mouse KIF21A (KIAA1708) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK17080310 |
| Quantity |
:100 µg (200 µL) |
| Gene |
:mouse immunoglobulin superfamily containing leucine-rich repeat 2 (mKIF21A, mKIAA1708) |
| Immunogen |
:GX0999 (GST-fusion protein, 286 amino acids)
YQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELTKRREKLSK
RREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKEEGETLDVTAVINAC
TLTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPEL
DALLGHALQDLDGAPPENEEDSSEEDGPLHSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQ
MELLYADSSEVASDTSAGDASLSGPLAPV |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Immunoprecipitation, Immunohistochemistry.
Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0999. This antibody detects endogenous mKIF21A protein in several
tissues and cells. Details are shown in the InGaP database. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Anti-Mouse KIF21A (KIAA1708)

Western blot analysis
- Adult Mouse Tissues -
- 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
-
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Shimizu, S. et al.: Jpn J Ophthalmol., 49, 443 (2005).
Aliases for KIF21A Gene
- Kinesin Family Member 21A 2 3 5
- Renal Carcinoma Antigen NY-REN-62 3 4
- Kinesin-Like Protein KIF21A 3 4
- Kinesin-Like Protein KIF2 3 4
- Fibrosis Of The Extraocular Muscles, Congenital, 1 2
- FLJ20052 2
- KIAA1708 4
- CFEOM1 3
- FEOM3A 3
- KIF21A 5
- FEOM1 3
- KIF2 4