Anti-Mouse KIF21A (KIAA1708) Polyclonal Antibody, Rabbit

Product#: MK17080310
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse KIF21A (KIAA1708) Polyclonal Antibody, Rabbit


General information 

Cat. No. MK17080310
Quantity 100 µg (200 µL)
Gene mouse immunoglobulin superfamily containing leucine-rich repeat 2 (mKIF21A, mKIAA1708)
Immunogen GX0999 (GST-fusion protein, 286 amino acids)
    YQRKGFTGRVFTSKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLRQREELTKRREKLSK
    RREKIVKESGEGDKSVANIIEEMESLTANIDYINDSIADCQANIMQMEEAKEEGETLDVTAVINAC
    TLTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPEL
    DALLGHALQDLDGAPPENEEDSSEEDGPLHSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQ
    MELLYADSSEVASDTSAGDASLSGPLAPV
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   Western blotting (1 : 1,000), Immunoprecipitation, Immunohistochemistry.
    Other applications have not been tested.
Specificity
Specific to recombinant protein GX0999. This antibody detects endogenous mKIF21A protein in several
    tissues and cells. Details are shown in the InGaP database.
 Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

Anti-Mouse KIF21A (KIAA1708)
MK17080310_fig2.png

Western blot analysis

  • Adult Mouse Tissues -
    •  1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
  • Cell Lines - 
    • 12:B16 cells, 13:F9 cells, 14:Neuro2A cells. 
    •  


References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Shimizu, S. et al.: Jpn J Ophthalmol., 49, 443 (2005). 
 

Aliases for KIF21A Gene

  • Kinesin Family Member 21A 2 3 5
  • Renal Carcinoma Antigen NY-REN-62 3 4
  • Kinesin-Like Protein KIF21A 3 4
  • Kinesin-Like Protein KIF2 3 4
  • Fibrosis Of The Extraocular Muscles, Congenital, 1 2
  • FLJ20052 2
  • KIAA1708 4
  • CFEOM1 3
  • FEOM3A 3
  • KIF21A 5
  • FEOM1 3
  • KIF2 4


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X