Anti-Mouse JMJD1C (KIAA1380) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MKA1380AF |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse Jumonji domain-containing protein 1C (Probable JmjC domain-containing histone demethylation
protein 2C, JMJD1C) (mJMJD1C, mKIAA1380) |
| Immunogen |
:GX1365 (GST-fusion protein, 219 amino acids)
VAAAKDHDIGTTNLHIEASDVVNVLVYVGIAKGNGVLSKAGILKKFEEEELDDVLRKILKDSSEIPG
ALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNRKLRQRLLEEYGVRACTLIQF
LGDAIVLPAGTLHQVQNFHSCVQVTEDFVSPEHLVQSFHLTQELRLLKEEINYDDKLQVKNILYH
AVKEMVRALKMHEDEVEDMEDT |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX1365. This antibody detects mJMJD1C protein.
Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Description
Mouse KIAA1380 (mKIAA1380) protein is a homologue of human KIAA1380 (ref. 1). KIAA1380 is identical to Jumonji domain-containing protein 1C (Probable JmjC domain-containing histone demethylation protein 2C, JMJD1C). Rabbit anti-mouse JMJD1C (mJMJD1C, mKIAA1380) antibody is raised against GST-fused recombinant protein (GX1365) containing following sequence:
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for JMJD1C Gene
- Jumonji Domain Containing 1C 2 3 5
- Probable JmjC Domain-Containing Histone Demethylation Protein 2C 3 4
- Thyroid Receptor-Interacting Protein 8 3 4
- Thyroid Hormone Receptor Interactor 8 2 3
- TR-Interacting Protein 8 3 4
- KIAA1380 2 4
- TRIP-8 3 4
- KDM3C 2 3
- TRIP8 3 4
- Jumonji Domain-Containing Protein 1C 4
- DKFZp761F0118 2
- EC 1.14.11.- 4
- EC 1.14.11 51
- FLJ14374 2
- JMJD1C 5
- JHDM2C 4