Anti-Mouse GCC2 (KIAA0336) Polyclonal Antibody, Rabbit

Product#: FNK-MK03360310
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse GCC2 (KIAA0336) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MK03360310
Quantity 100 µg (200 µL)
Gene :mouse GRIP and coiled-coil domain-containing protein 2 (mGCC2, mKIAA0336)
Immunogen GX0491 (GST-fusion protein, 243 amino acids)
    KVRVHNVLKQQKNKSVSQVETEGAKQEREHLEMLIDQLKIKLQDSQNSLQISVSEYQTLQAEHD
    TLLERHNRMLQETVTKEAELREKLCSVQSENTMMKSEHSQTMCQLTSQNEALRTSFRDQVRH
    LQDEHRKTVETLQHQLSKLEAQLFQLKSEPSTRSPASSHQPSKSLRERRTTDLPLLDMHTVARE
    EGEGMETTDSESVSSAGTHIQSLEQLLSSPDTKLERLAETSLWHNEFTKEELA
Format Rabbit IgG purified with Protein A affinity chromatography.
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse 
Application   :Western blotting (1 : 1,000), Immunoprecipitation, Immunohistochemistry.
    Other applications have not been tested.
Specificity
Specific to recombinant protein GX0491. This antibody detects endogenous mGCC2 protein
    in several tissues and cells. Details are shown in the InGaP database. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

Anti-Mouse GCC2 (KIAA0336)
MK03360310_fig2.png


Western blot analysis

  • Adult Mouse Tissues -
    • 10:Brain, 11:Prostate.6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 
  • Cell Lines -
    • 12:B16 cells, 13:F9 cells, 14:Neuro2A cell


References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Luke, M.R. et al.: J Biol Chem., 278, 4216 (2003). 
 

Aliases for GCC2 Gene

  • GRIP And Coiled-Coil Domain Containing 2 2 3 5
  • GCC185 2 3 4
  • GRIP And Coiled-Coil Domain-Containing Protein 2 3 4
  • 185 KDa Golgi Coiled-Coil Protein 3 4
  • Renal Carcinoma Antigen NY-REN-53 3 4
  • CLL-Associated Antigen KW-11 3 4
  • Ran-Binding Protein 2-Like 4 3 4
  • CTCL Tumor Antigen Se1-1 3 4
  • RANBP2L4 3 4
  • KIAA0336 2 4
  • GRIP And Coiled-Coil Domain-Containing 2 2
  • Golgi Coiled-Coil Protein GCC185 3
  • GCC Protein, 185-KD 3
  • RanBP2L4 4
  • REN53 3
  • GCC2 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X