Anti-Mouse GARNL1 (KIAA0884) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK08840910 |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse GAP-related interacting partner to E12 (GARNL1) (mGARNL1, mKIAA0884) |
| Immunogen |
:GX0664 (GST-fusion protein, 158 amino acids)
MRPVDDPGVPSEWTSPASAGSSDLMSSDSHSDSFSAFQCEGRKFDNFGFGTDIGIPSSADVD
LGSGHHQSTEEQEVASLTTLHLDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSP
STLSRAHIEQKDLQLDEKLHHSVLQTPDDLGNA |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0664. This antibody detects mGARNL1 protein. Details are shown
in the InGaP database. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for RALGAPA1 Gene
- Ral GTPase Activating Protein Catalytic Subunit Alpha 1 2 3 5
- Tuberin-Like Protein 1 2 3 4
- GRIPE 2 3 4
- Ral GTPase-Activating Protein Subunit Alpha-1 3 4
- GTPase Activating Rap/RanGAP Domain-Like 1 2 3
- GAP-Related Interacting Protein To E12 2 3
- RalGAPalpha1 2 3
- KIAA0884 2 4
- GARNL1 3 4
- TULIP1 3 4
- P240 3 4
- Ral GTPase Activating Protein, Alpha Subunit 1 (Catalytic) 3
- Ral GTPase Activating Protein Catalytic Alpha Subunit 1 3
- GTPase-Activating Rap/Ran-GAP Domain-Like 1 4
- GTPase Activating RANGAP Domain-Like 1 2
- GAP-Related-Interacting Partner To E12 4
- DKFZp667F074 2
- RALGAPA1 5
- NEDHRIT 3
- Tulip1 2