Anti-Mouse GARNL1 (KIAA0884) Polyclonal Antibody, Rabbit

Product#: MK08840910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse GARNL1 (KIAA0884) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK08840910
Quantity 50 µg (250 µL)
Gene :mouse GAP-related interacting partner to E12 (GARNL1) (mGARNL1, mKIAA0884)
Immunogen GX0664 (GST-fusion protein, 158 amino acids)
    MRPVDDPGVPSEWTSPASAGSSDLMSSDSHSDSFSAFQCEGRKFDNFGFGTDIGIPSSADVD
    LGSGHHQSTEEQEVASLTTLHLDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSP
    STLSRAHIEQKDLQLDEKLHHSVLQTPDDLGNA
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0664. This antibody detects mGARNL1 protein. Details are shown
    in the InGaP database.  Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for RALGAPA1 Gene

  • Ral GTPase Activating Protein Catalytic Subunit Alpha 1 2 3 5
  • Tuberin-Like Protein 1 2 3 4
  • GRIPE 2 3 4
  • Ral GTPase-Activating Protein Subunit Alpha-1 3 4
  • GTPase Activating Rap/RanGAP Domain-Like 1 2 3
  • GAP-Related Interacting Protein To E12 2 3
  • RalGAPalpha1 2 3
  • KIAA0884 2 4
  • GARNL1 3 4
  • TULIP1 3 4
  • P240 3 4
  • Ral GTPase Activating Protein, Alpha Subunit 1 (Catalytic) 3
  • Ral GTPase Activating Protein Catalytic Alpha Subunit 1 3
  • GTPase-Activating Rap/Ran-GAP Domain-Like 1 4
  • GTPase Activating RANGAP Domain-Like 1 2
  • GAP-Related-Interacting Partner To E12 4
  • DKFZp667F074 2
  • RALGAPA1 5
  • NEDHRIT 3
  • Tulip1 2


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X