- Home
- Antibody
- Antigen F-G
- Anti-Mouse FBXW11 (KIAA0696) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje and Molecular layer)
Anti-Mouse FBXW11 (KIAA0696) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje and Molecular layer)
Product#: FNK-MK06960310
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse FBXW11 (KIAA0696) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje and Molecular layer)
General information
| Cat. No. | ：FNK-MK06960310 |
| Quantity | ：100 µg (200 µL) |
| Gene | ：mouse F-box and WD-40 domain protein 11 (FBXW11) (mFBXW11, mKIAA0696) |
| Immunogen | ：GX0195 (GST-fusion protein, 108 amino acids) CLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRL QFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR |
| Format | ：Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Immunohistochemistry. Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0195. This antibody detects endogenous mFBXW11 protein
in cerebellar purkinje and molecular layer cells. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Cenciarelli, C. et al.: Curr Biol., 9, 1177 (1999).
Aliases for FBXW11 Gene
- F-Box And WD Repeat Domain Containing 11 2 3 5
- BTRCP2 2 3 4
- F-Box And WD Repeats Protein Beta-TrCP2 3 4
- F-Box/WD Repeat-Containing Protein 11 3 4
- F-Box/WD Repeat-Containing Protein 1B 3 4
- F-Box And WD-40 Domain Protein 1B 2 3
- F-Box And WD-40 Domain Protein 11 2 3
- Homologous To Slimb Protein 3 4
- KIAA0696 2 4
- FBXW1B 3 4
- BTRC2 2 3
- FBW1B 3 4
- Fbw11 2 3
- Hos 2 3
- Beta-Transducin Repeat-Containing Protein 2 3
- F-Box Protein Fbw1b 3
- NEDJED 3
- FBXW11 5
- Fbw1b 2
- HOS 4
