Anti-Mouse ERC2 (KIAA0378) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje cell)

Product#: FNK-MK03780310
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse ERC2 (KIAA0378) Polyclonal Antibody, Rabbit (Cerebellum, Purkinje cell)


General information 

Cat. No. :FNK-MK03780310
Quantity :100 µg (200 µL)
Gene :mouse ELKS/RAB6-interacting/CAST family member 2 (ERC2) (mERC2, mKIAA0378)
Immunogen :GX0090 (GST-fusion protein, 153 amino acids)
    LMNALEKTRQELDATKARLASTQQSLAEKEAHLANLRIERRKQLEEILEMKQEALLAAISEKDANI
    ALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRMKLMADNYDEDHHHYHHHHHHHHH 
    RSPGRSQHSNHRPSPDQDDEEGIWA
Format :Rabbit IgG purified with Protein A affinity chromatography.
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Mouse
Application   :Immunohistochemistry. Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0090. This antibody detects endogenous mERC2 protein in
    cerebellar purkinje cells. Other species have not been tested.
Storage :Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Ko, J. et al.: J Biol Chem., 278, 42377 (2003).
  4. Takao-Rikitsu, E. et al.: J Cell Biol., 164, 301 (2004). 
 

Aliases for ERC2 Gene

  • ELKS/RAB6-Interacting/CAST Family Member 2 2 3 5
  • ERC Protein 2 3 4
  • KIAA0378 2 4
  • SPBC110 2 3
  • Spc110 2 3
  • CAST1 2 3
  • ELKSL 2 3
  • CAST 2 3
  • CAZ-Associated Structural Protein 3
  • Cytomatrix Protein P110 3
  • ERC2 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X