Anti-Mouse CSTF2T (KIAA0689) Polyclonal Antibody, Rabbit
Product#: FNK-MK06890910
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse CSTF2T (KIAA0689) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MK06890910 |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse cleavage stimulation factor, 3' pre-RNA subunit 2, tau (CSTF2T) (mCSTF2T, mKIAA0689) |
| Immunogen | ：GX1513 (GST-fusion protein, 213 amino acids) RGGRESRGMETRPMETEVLEPRGMERRMETCAMETRGMDARGLEMRGPGPSSRGPMTGGI QGPGPINMGAGGPQGPRQVPNIAGVGNPGGTMQGAGIQGGGMQGAGMQGGGMQGAGMQ GGGMQGAGMQAGMQGASMQGGMQGAGMQGASKQGGGQPSSFSPGQSQVTPQDQEKAAL IMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX1513. This antibody detects mCSTF2T protein. Details are shown
in the InGaP database. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type:Primary
- Application:ELISA,Western Blot,Immunofluorescence
- Species:Human
- Recombinant:Yes
Human Diseases
- Overexpression linked to various cancers, including hepatocellular carcinoma (HCC)
- Associated with poor prognosis and unfavorable outcomes in cancer patients
- Implicated in spermatogenesis; mutations can lead to male infertility
Cellular Signaling Pathways
- Modulates the Wnt/β-catenin signaling pathway, influencing cell proliferation and survival
- Involved in mRNA polyadenylation, affecting gene expression in immune cells
- Plays a role in DNA/RNA processing and cell cycle regulation
Aliases for CSTF2T Gene
- Cleavage Stimulation Factor Subunit 2 Tau Variant 2 3 4 5
- TauCstF-64 2 3 4
- CstF-64T 2 3
- KIAA0689 2 4
- Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, Tau Variant 2
- Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, Tau Variant 2
- Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, Tau 3
- Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, Tau 3
- Cleavage Stimulation Factor 64 KDa Subunit Tau Variant 4
- Cleavage Stimulation Factor Subunit 2, Tau Variant 2
- Cleavage Stimulation Factor 64 KDa Subunit Tau 3
- Cleavage Stimulation Factor Subunit 2, Tau 3
- CF-1 64 KDa Subunit Tau Variant 4
- CSTF 64 KDa Subunit Tau Variant 4
- CF-1 64 KDa Subunit Tau 3
- CSTF 64 KDa Subunit Tau 3
- DKFZp434C1013 2
- CSTF2T 5
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Zhang, Wang, et al. “CSTF2 Acts as a Prognostic Marker Correlated with Immune Infiltration: CMAR.” Cancer Management and Research, Dove Press, 12 Sept. 2022, www.dovepress.com/cstf2-acts-as-a-prognostic-marker-correlated-with-immune-infiltration--peer-reviewed-fulltext-article-CMAR.
- Harris, Jaryse C, et al. “The CSTF2T Polyadenylation Gene Plays a Sex-Specific Role in Learning Behaviors in Mice.” PloS One, U.S. National Library of Medicine, 3 Nov. 2016, www.ncbi.nlm.nih.gov/pmc/articles/PMC5094787/.
- Anti-CSTF2T Antibody [EPR8924].” Abcam, www.abcam.com/en-us/products/primary-antibodies/cstf2t-antibody-epr8924-ab138486.
- CSTF2T Antibody (ABIN6258757).” CSTF2T Antibody (ABIN6258757), www.antibodies-online.com/antibody/6258757/anti-Cleavage+Stimulation+Factor,+3+Pre-RNA,+Subunit+2,+64kDa,+tau+Variant+CSTF2T+N-Term+antibody/.
