Anti-Mouse CLINT1 (KIAA0171) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0171AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse CLINT1 (KIAA0171) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0171AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse clathrin interactor 1 (CLINT1) (mCLINT1, mKIAA0171) |
| Immunogen | ：GX1456 (GST-fusion protein, 158 amino acids) ETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSAKPSVPS SKSSGDLVDLFDGSSQSAATSGNGDFGDWSAFNQAPSGPVASGGELFGSAPQSAVELISASQ PALGPPPAASNSADLFDLMGSSQATMTSSQS |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX1456. This antibody detects mCLINT1 protein.
Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type:Primary
- Application:ELISA, Western Blot
- Species:Human
- Recombinant:Yes
Human Diseases
- Schizophrenia: Variants in the CLINT1 gene have been associated with increased susceptibility to schizophrenia, potentially influencing neurotransmitter receptor turnover.
- Psychotic Disorders: Alterations in clathrin-mediated endocytosis may contribute to symptoms like delusions and hallucinations.
Cellular Signaling Pathways
- Clathrin-Mediated Endocytosis: CLINT1 interacts with clathrin and AP-1, facilitating the assembly of clathrin-coated vesicles crucial for receptor internalization.
- Neurotransmitter Regulation: By regulating the turnover of neuroreceptors, CLINT1 plays a role in maintaining synaptic function and plasticity.
Aliases for CLINT1 Gene
- Clathrin Interactor 1 2 3 4 5
- ENTH 2 3 4
- EPNR 2 3 4
- Epsin-Related Protein 3 4
- Enthoprotin 3 4
- KIAA0171 2 4
- EpsinR 3 4
- CLINT 2 3
- EPN4 3 4
- Clathrin Interacting Protein Localized In The Trans-Golgi Region 3
- Clathrin-Interacting Protein Localized In The Trans-Golgi Region 4
- Epsin 4 3
- Epsin-4 4
- CLINT1 5
- Clint 4
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- 10470-1-AP.” CLINT1 Antibody (10470-1-AP) | Proteintech, 31 Aug. 2024, www.ptglab.com/products/CLINT1-Antibody-10470-1-AP.htm.
- Consortium, String. CLINT1 Protein (Human) - String Interaction Network, string-db.org/network/9606.ENSP00000429824.
- Clint1 Proteins, www.antibodies-online.com/cl/clint1-50883/clint1-proteins-32552/.
- Kalthoff C;Groos S;Kohl R;Mahrhold S;Ungewickell EJ; “Clint: A Novel Clathrin-Binding Enth-Domain Protein at the Golgi.” Molecular Biology of the Cell, U.S. National Library of Medicine, pubmed.ncbi.nlm.nih.gov/12429846/.
Recently Viewed
Bacterial DNA Kit (4 Preps)
$200.00
Ppc-1, MitoUncoupler
$358.80
WEPRO8240 (15N) Core Kit
$4650.64
Bacterial DNA Kit (50 Preps)
$110.00
DynaMarker, Small RNA II
$320.00
