Anti-Mouse CLINT1 (KIAA0171) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0171AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse CLINT1 (KIAA0171) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKA0171AF
Quantity :50 µg (250 µL)
Gene :mouse clathrin interactor 1 (CLINT1) (mCLINT1, mKIAA0171)
Immunogen :GX1456 (GST-fusion protein, 158 amino acids) 
    ETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSAKPSVPS
    SKSSGDLVDLFDGSSQSAATSGNGDFGDWSAFNQAPSGPVASGGELFGSAPQSAVELISASQ 
    PALGPPPAASNSADLFDLMGSSQATMTSSQS
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX1456. This antibody detects mCLINT1 protein.
    Other species have not been tested.
Storage :Store at -20°C. Avoid freeze-thaw cycles.
Shipping Condition  :Dry Ice 
 

Antigen Characterization 

  • Type:Primary
  • Application:ELISA, Western Blot
  • Species:Human
  • Recombinant:Yes


Human Diseases

  • Schizophrenia: Variants in the CLINT1 gene have been associated with increased susceptibility to schizophrenia, potentially influencing neurotransmitter receptor turnover.
  • Psychotic Disorders: Alterations in clathrin-mediated endocytosis may contribute to symptoms like delusions and hallucinations.


Cellular Signaling Pathways

  • Clathrin-Mediated Endocytosis: CLINT1 interacts with clathrin and AP-1, facilitating the assembly of clathrin-coated vesicles crucial for receptor internalization.
  • Neurotransmitter Regulation: By regulating the turnover of neuroreceptors, CLINT1 plays a role in maintaining synaptic function and plasticity.
     

Aliases for CLINT1 Gene

  • Clathrin Interactor 1 2 3 4 5
  • ENTH 2 3 4
  • EPNR 2 3 4
  • Epsin-Related Protein 3 4
  • Enthoprotin 3 4
  • KIAA0171 2 4
  • EpsinR 3 4
  • CLINT 2 3
  • EPN4 3 4
  • Clathrin Interacting Protein Localized In The Trans-Golgi Region 3
  • Clathrin-Interacting Protein Localized In The Trans-Golgi Region 4
  • Epsin 4 3
  • Epsin-4 4
  • CLINT1 5
  • Clint 4


References

  • Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
  • 10470-1-AP.” CLINT1 Antibody (10470-1-AP) | Proteintech, 31 Aug. 2024, www.ptglab.com/products/CLINT1-Antibody-10470-1-AP.htm. 
  • Consortium, String. CLINT1 Protein (Human) - String Interaction Network, string-db.org/network/9606.ENSP00000429824. 
  • Clint1 Proteins, www.antibodies-online.com/cl/clint1-50883/clint1-proteins-32552/. 
  • Kalthoff C;Groos S;Kohl R;Mahrhold S;Ungewickell EJ; “Clint: A Novel Clathrin-Binding Enth-Domain Protein at the Golgi.” Molecular Biology of the Cell, U.S. National Library of Medicine, pubmed.ncbi.nlm.nih.gov/12429846/. 

Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X