Anti-Mouse CHTF18 (FLJ00069) Polyclonal Antibody, Rabbit
Product#: FNK-MFL0069AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse CHTF18 (FLJ00069) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MFL0069AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse CTF18, chromosome transmission fidelity factor 18 homolog (mCHTF18, mFLJ00069) |
| Immunogen | ：GX0930 (GST-fusion protein, 191 amino acids) EKQQLSCLVGTMLAYSLTYHQERTPDGQYLYKLEPNVEEVCRFPELPARKPLTYQAKQLIAREI EMEKMRRAEALAWARSGPQVDQGSSGPASLWTDSGEKGTRQPVPRNHEQRLEHIMTRATVQ EQPERDFFGRVVIRKVAVPSREVEAPQKDADEWRMGVAVGRSEVWFRFNEGVSNAVRRSLYI RDLL |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0930. This antibody detects mCHTF18 protein.
Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type:Primary
- Application:Western Blot (WB): Used for detecting and quantifying specific proteins.,ELISA: Employed for measuring protein concentrations in various samples.
- Species:Human
- Recombinant:Yes
Human Diseases
- Infertility: Disruption of CHTF18 has been linked to reduced sperm concentration and abnormal spermatogenesis, leading to male subfertility.
- Cancer: Potential involvement in genomic stability may relate to tumorigenesis when CHTF18 function is impaired.
- Genetic Disorders: Mutations or dysregulation of CHTF18 may contribute to developmental issues due to its role in chromosome transmission fidelity.
- Neurodegenerative Diseases: Implications in DNA repair mechanisms could affect neuronal health and function.
Cellular Signaling Pathways
- DNA Repair Pathway: Functions in the repair of double-strand breaks during meiosis, essential for maintaining genomic integrity.
- Chromosome Segregation: Plays a critical role in ensuring accurate chromosome segregation during cell division, particularly during meiosis.
- Germ Cell Development: Involved in pathways regulating spermatogenesis and oogenesis, influencing fertility outcomes.
- Cell Cycle Regulation: May interact with other factors involved in cell cycle progression and stability.
Aliases for CHTF18 Gene
- Chromosome Transmission Fidelity Factor 18 2 3 5
- CHL12 2 3 4
- Chromosome Transmission Fidelity Protein 18 Homolog 3 4
- C16orf41 3 4
- C321D2.4 2 3
- Ctf18 2 3
- CTF18, Chromosome Transmission Fidelity Factor 18 Homolog (S. Cerevisiae) 2
- Some Homology With Holliday Junction DNA Helicase RUVB Like 3
- CTF18, Chromosome Transmission Fidelity Factor 18 Homolog 3
- Chromosome 16 Open Reading Frame 41 2
- C321D2.3 (Novel Protein) 3
- C321D2.4 (Novel Protein) 3
- Homolog Of Yeast CHL12 3
- C321D2.2 3
- C321D2.3 3
- EC 3.6.1 51
- CHTF18 5
- HCTF18 4
- RUVBL 3
- CTF18 4
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Berkowitz, Karen M., et al. “Disruption of CHTF18 Causes Defective Meiotic Recombination in Male Mice.” PLOS Genetics, Public Library of Science, journals.plos.org/plosgenetics/article?id=10.1371%2Fjournal.pgen.1002996. Accessed 27 Sept. 2024. '
- CHTF18 Chromosome Transmission Fidelity Factor 18 [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene/63922. Accessed 28 Sept. 2024.
- CHTF18 Protein Expression Summary - the Human Protein Atlas, www.proteinatlas.org/ENSG00000127586-CHTF18.
- Account - Genecards Suite, www.genecards.org/cgi-bin/carddisp.pl?gene=CHTF18.
- CHTF18 Recombinant Protein Antigen.” Novus Biologicals, www.novusbio.com/products/chtf18-recombinant-protein-antigen_nbp2-55371pep.
