Anti-Mouse CHTF18 (FLJ00069) Polyclonal Antibody, Rabbit

Product#: FNK-MFL0069AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse CHTF18 (FLJ00069) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MFL0069AF
Quantity 50 µg (250 µL)
Gene :mouse CTF18, chromosome transmission fidelity factor 18 homolog (mCHTF18, mFLJ00069)
Immunogen GX0930 (GST-fusion protein, 191 amino acids) 
    EKQQLSCLVGTMLAYSLTYHQERTPDGQYLYKLEPNVEEVCRFPELPARKPLTYQAKQLIAREI
    EMEKMRRAEALAWARSGPQVDQGSSGPASLWTDSGEKGTRQPVPRNHEQRLEHIMTRATVQ 
    EQPERDFFGRVVIRKVAVPSREVEAPQKDADEWRMGVAVGRSEVWFRFNEGVSNAVRRSLYI 
    RDLL
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0930. This antibody detects mCHTF18 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
Shipping Condition  :Dry Ice 
 

Antigen Characterization 

  • Type:Primary
  • Application:Western Blot (WB): Used for detecting and quantifying specific proteins.,ELISA: Employed for measuring protein concentrations in various samples.
  • Species:Human
  • Recombinant:Yes


Human Diseases

  • Infertility: Disruption of CHTF18 has been linked to reduced sperm concentration and abnormal spermatogenesis, leading to male subfertility.
  • Cancer: Potential involvement in genomic stability may relate to tumorigenesis when CHTF18 function is impaired.
  • Genetic Disorders: Mutations or dysregulation of CHTF18 may contribute to developmental issues due to its role in chromosome transmission fidelity.
  • Neurodegenerative Diseases: Implications in DNA repair mechanisms could affect neuronal health and function.


Cellular Signaling Pathways

  • DNA Repair Pathway: Functions in the repair of double-strand breaks during meiosis, essential for maintaining genomic integrity.
  • Chromosome Segregation: Plays a critical role in ensuring accurate chromosome segregation during cell division, particularly during meiosis.
  • Germ Cell Development: Involved in pathways regulating spermatogenesis and oogenesis, influencing fertility outcomes.
  • Cell Cycle Regulation: May interact with other factors involved in cell cycle progression and stability.
     

Aliases for CHTF18 Gene

  • Chromosome Transmission Fidelity Factor 18 2 3 5
  • CHL12 2 3 4
  • Chromosome Transmission Fidelity Protein 18 Homolog 3 4
  • C16orf41 3 4
  • C321D2.4 2 3
  • Ctf18 2 3
  • CTF18, Chromosome Transmission Fidelity Factor 18 Homolog (S. Cerevisiae) 2
  • Some Homology With Holliday Junction DNA Helicase RUVB Like 3
  • CTF18, Chromosome Transmission Fidelity Factor 18 Homolog 3
  • Chromosome 16 Open Reading Frame 41 2
  • C321D2.3 (Novel Protein) 3
  • C321D2.4 (Novel Protein) 3
  • Homolog Of Yeast CHL12 3
  • C321D2.2 3
  • C321D2.3 3
  • EC 3.6.1 51
  • CHTF18 5
  • HCTF18 4
  • RUVBL 3
  • CTF18 4


References

  • Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
  • Berkowitz, Karen M., et al. “Disruption of CHTF18 Causes Defective Meiotic Recombination in Male Mice.” PLOS Genetics, Public Library of Science, journals.plos.org/plosgenetics/article?id=10.1371%2Fjournal.pgen.1002996. Accessed 27 Sept. 2024. '
  • CHTF18 Chromosome Transmission Fidelity Factor 18 [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene/63922. Accessed 28 Sept. 2024.
  • CHTF18 Protein Expression Summary - the Human Protein Atlas, www.proteinatlas.org/ENSG00000127586-CHTF18. 
  • Account - Genecards Suite, www.genecards.org/cgi-bin/carddisp.pl?gene=CHTF18. 
  • CHTF18 Recombinant Protein Antigen.” Novus Biologicals, www.novusbio.com/products/chtf18-recombinant-protein-antigen_nbp2-55371pep. 
     

Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X