Anti-Mouse CCDC35 (FLJ00251) Polyclonal Antibody, Rabbit
Anti-Mouse CCDC35 (FLJ00251) Polyclonal Antibody, Rabbit
DiagnoCine offers multiple types of excellent Dynein I Anti- Dynein Antibodies to researchers studying Cellular Functions, Organelle Transportation, Cellular Respiration, Mitotic Spindle Positioning, Cell Division, Microtubule, and Intracellular Replication.
Human diseases include Defective brain development, Congenital anomalies, Impaired cognitive function, Muscular dystrophy, Motor neuron degeneration, Lissencephaly, Amyotrophic lateral sclerosis, Huntington's disease, and Alzheimer's disease.
Anti- Dynein Antibodies have excellent quality and this highly pure antibody can be adapted for Western Blots research with optimization.
General information
| Cat. No. | ：FNK-MFL0251AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Coiled-coil domain-containing protein 35 (mCCDC35, mFLJ00251) |
| Immunogen | ：GX2020 (GST-fusion protein, 214 amino acids) SGHDVQEELGSKLNNMRKNILEQAQNECWSRNQQLMTELTEFLRVFQTISSDIHAIAQCSQKLS EANEQYCQLEERVEYVRSLHDLIRNHCALFIAENETLDIALLDLWEAFQFERSQVSEFLLSKQHAI VPRLQQLMAAALAELEGLLAKALSGPFMDPSQEQRSTEQQLGALEHQFLNILNNFNALCNAYCT FTGTEHHHLCFYPGRTLHLR |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX2020. This antibody detects mCCDC35 protein.
Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type:Primary
- Application:ELISA,Western Blot,Immunofluorescence
- Species:Human
- Recombinant:Yes
Human Diseases
- Associated with Multiple Morphological Abnormalities of the Sperm Flagellum (MMAF)
- Mutations in CCDC35 (DNHD1) linked to male infertility
- Implicated in sperm motility disorders
Cellular Signaling Pathways
- Involved in ciliary and flagellar function
- Associated with dynein motor activity, crucial for cellular transport and movement
- Plays a role in the assembly and maintenance of cilia and flagella
Aliases for DNHD1 Gene
- Dynein Heavy Chain Domain 1 2 3 5
- Dynein Heavy Chain Domain-Containing Protein 1 3 4
- Dynein Heavy Chain Domain 1-Like Protein 3 4
- Coiled-Coil Domain Containing 35 2 3
- C11orf47 3 4
- CCDC35 3 4
- DNHD1L 3 4
- DHCD1 3 4
- Chromosome 11 Open Reading Frame 47 2
- Dynein Heavy Chain Domain 1-Like 2
- DNHD1 Variant Protein 3
- Protein CCDC35 4
- DKFZp686J0796 2
- FLJ32752 2
- FLJ46184 2
- FLJ35709 2
- DNHD1 5
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Magentech. “Anti-Mouse CCDC35 (FLJ00251) Polyclonal Antibody, Rabbit.” Your Store, diagnocine.com/Product/AntiMouse-CCDC35-FLJ00251-Polyclonal-Antibody-Rabbit/52029.
- CCDC35 Antibody - Mybiosource.” Main Menu, www.mybiosource.com/CCDC35-Antibody.
- CCDC35.” Nordic Biosite, nordicbiosite.com/product/181-MFL0251AF-50/CCDC35.
