Anti-Mouse C1orf71 (FLJ00215) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MFL0215AF |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse uncharacterized protein C1orf71 (mC1orf71, mFLJ00215) |
| Immunogen |
:GX2268 (GST-fusion protein, 125 amino acids)
MAPEERRDSEDRVSKETEDYLHSLLERCLKDAEDSLSYEDIQDDDSDLLQDLSPEEASYSLQED
LPPDESTLSLDDLAKKIEIAEAIPAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEID |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX2268. This antibody detects mC1orf71 protein.
Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
| Shipping Condition |
:Dry Ice |
Antigen Characterization
- Type:Primary
- Application:Western Blot,ELISA
- Species:Human
- Recombinant:Yes
Human Diseases
- Potential role in neurodegenerative disorders due to involvement in protein misfolding and aggregation pathways612
- May be implicated in mental disorders through ER stress and autophagy mechanisms13
Cellular Signaling Pathways
- Endoplasmic reticulum (ER) stress response pathway213
- Unfolded protein response (UPR) signaling26
- Autophagy pathways13
- Protein quality control mechanisms612
Aliases for CNST Gene
- Consortin, Connexin Sorting Protein 2 3 5
- Protein Phosphatase 1, Regulatory Subunit 64 2 3
- Consortin 3 4
- C1orf71 3 4
- PPP1R64 2 3
- Chromosome 1 Open Reading Frame 71 2
- FLJ32001 2
- CNST 5
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- del Castillo, Francisco J., et al. "Consortin, a Trans-Golgi Network Cargo Receptor for the Plasma Membrane Targeting and Recycling of Connexins." Human Molecular Genetics, vol. 19, no. 2, 15 Jan. 2010, pp. 262-274.
- "CNST Gene - Ma'ayan Laboratory, Computational Systems Biology." Ma'ayan Laboratory, Computational Systems Biology, 1 Jan. 2023, maayanlab.cloud/Harmonizome/gene/CNST.
- "CNST Consortin, Connexin Sorting Protein [Homo Sapiens (Human)]." National Center for Biotechnology Information, U.S. National Library of Medicine, 1 Jan. 2024, www.ncbi.nlm.nih.gov/gene/163882.
- "CNST Gene - Consortin, Connexin Sorting Protein - GeneCards." GeneCards, www.genecards.org/cgi-bin/carddisp.pl?gene=CNST.
- "CNST - Consortin - Homo Sapiens (Human)." UniProt, www.uniprot.org/uniprotkb/Q6PJW8/entry.