/Content/Upload/Product/ComingSoon_image-call_w600_Diagnocine_1200_1076.jpg

Anti-KLHL25, Human, Rabbit-Poly

Product#: FNK-KB9611GNP

$297.23

Qty:

Availability:

Ships in 48 hours

Anti-KLHL25, Human, Rabbit-Poly

Cat. No.: FNK-KB9611GNP

Size: 100μL

Storage: -20°C. Avoid freeze-thaw cycles.

Antigen Species: Human

Host Species: Rabbit

Cross Reactivity: Human

Label: Unlabeled

Purification: Serum

Specifications

Gene: KLHL25 (Ectoderm-neural cortex protein 2, ENC-2, Kelch-like protein 25)

Immunogen: GX5438 (GST-fusion protein, 164 amino acids)
MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRL

Format: Rabbit Whole Serum.

Preservative: 0.05 % NaN3

Quantity: 100 µL

Specificity: This antibody detects human KLHL25 protein. Other species have not been tested.

Application: Western blotting (1 : 1,000), Other applications have not been tested.

For research use only, not for diagnostic use