Anti-Human SMARCC2 Polyclonal Antibody, Rabbit

Product#: FNK-KB4171GNPAF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Human SMARCC2 Polyclonal Antibody, Rabbit


General information 

 Cat. No. :FNK-KB4171GNPAF
Quantity :100 µL
Gene SMARCC2 (SWI/SNF complex subunit SMARCC2, SWI/SNF-related matrix-associated actin-dependent
    regulator of chromatin subfamily C member 2, SWI/SNF complex 170 kDa subunit, BRG1-associated 
    factor 170)
Immunogen GX5112 (GST-fusion protein, 170 amino acids)
    MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEV
    FGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMT
    IEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTED
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 40% glycerol and 0.02% of NaN3
Antigen Species :Human 
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:This antibody detects human SMARCC2 protein. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles. 
 

Aliases for SMARCC2 Gene

  • SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin Subfamily C Member 2 2 3 5
  • BAF170 2 3 4
  • SWI/SNF Complex Subunit SMARCC2 3 4
  • SWI/SNF Complex 170 KDa Subunit 3 4
  • CRACC2 2 3
  • Rsc8 2 3
  • SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin, Subfamily C, Member 2 2
  • SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator Of Chromatin Subfamily C Member 2 4
  • Mammalian Chromatin Remodeling Complex BRG1-Associated Factor 170 3
  • Chromatin Remodeling Complex BAF170 Subunit 3
  • BRG1-Associated Factor 170 4
  • SWI3-Like Protein 3
  • SMARCC2 5
  • CSS8 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X