Anti-Human PML Polyclonal Antibody, Rabbit

Product#: KB4394GNPAF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Human PML Polyclonal Antibody, Rabbit


General information 

Cat. No. :KB4394GNPAF
Quantity 50 µg (250 µL)
Gene PML (Probable transcription factor PML, Tripartite motif-containing protein 19, RING finger protein 71)
Immunogen GX5060 (GST-fusion protein, 173 amino acids)
    ARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSS
    EDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQ
    LAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRR
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 40% glycerol and 0.02% of NaN3
Antigen Species :Human 
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:This antibody detects human PML protein. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

Aliases for PML Gene

  • PML Nuclear Body Scaffold 2 3
  • TRIM19 2 3 4
  • RNF71 2 3 4
  • MYL 2 3 4
  • Tripartite Motif-Containing Protein 19 3 4
  • Promyelocytic Leukemia Protein 3 4
  • Promyelocytic Leukemia 2 5
  • RING Finger Protein 71 3 4
  • Protein PML 3 4
  • PP8675 3 4
  • Promyelocytic Leukemia, Inducer Of 3
  • Probable Transcription Factor PML 3
  • Tripartite Motif Protein TRIM19 3
  • PML/RARA Fusion 3
  • PML 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X