Anti-CEBPG, Human, Rabbit-Poly
Cat. No.:
FNK-KB9586GNP
Size: 100μL
Storage: -20°C. Avoid freeze-thaw cycles.
Antigen Species: Human
Host Species: Rabbit
Cross Reactivity: Human
Label: Unlabeled
Purification: Serum
Specifications
Gene: CEBPG (CCAAT/enhancer-binding protein gamma, C/EBP gamma)
Immunogen: GX5130 (GST-fusion protein, 105 amino acids)
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLE
Format: Rabbit Whole Serum.
Preservative: 0.05 % NaN3
Quantity: 100 µL
Specificity: This antibody detects human CEBPG protein. Other species have not been tested.
Application: Western blotting (1 : 1,000), Other applications have not been tested.
For research use only, not for diagnostic use
