Anti-ANP32A, Human, Rabbit-Poly
Cat. No.:
FNK-KB7264GNP
Size: 100μL
Storage: -20°C. Avoid freeze-thaw cycles.
Antigen Species: Human
Host Species: Rabbit
Cross Reactivity: Human
Label: Unlabeled
Purification: Serum
Specifications
Gene: ANP32A (Acidic leucine-rich nuclear phosphoprotein 32 family member A, Potent heat-stable protein phosphatase 2A inhibitor I1PP2A, Acidic nuclear phosphoprotein pp32, Leucine-rich acidic nuclear protein, Lanp, Putative HLA-DR-associated protein I, PHAPI, Mapmodulin)
Immunogen: GX5388 (GST-fusion protein, 153 amino acids)
LELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAE
Format: Rabbit Whole Serum.
Preservative: 0.05 % NaN3
Quantity: 100 µL
Specificity: This antibody detects human ANP32A protein. Other species have not been tested.
Application: Western blotting (1 : 1,000), Other applications have not been tested.
For research use only, not for diagnostic use
