Anti-Mouse ZCCHC11 (KIAA0191) Polyclonal Antibody, Rabbit

Product#: MKA0191AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse ZCCHC11 (KIAA0191) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0191AF
Quantity 50 µg (250 µL)
Gene :mouse Zinc finger CCHC domain-containing protein 11 (ZCCHC11) (mZCCHC11, mKIAA0191)
Immunogen GX2516 (GST-fusion protein, 249 amino acids)
    ESQQTGKKLTSSFVSMDKRKSEALQGEKSALENSSLSQKQQTQTDNIADSDDSASGIEDTADD
    LSKMKSEESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKRSPEYTNC
    RYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPSPSSAHLAALSVAVVELAKEQGIT
    DDDLRIRQDIVEEMSKVIMTFLPECSLRLYGSSLTKFALKSSDVNIDIKFPPKMN
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX2516. This antibody detects mZCCHC11 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for ZCCHC11 Gene

  • Terminal Uridylyl Transferase 4 2 3 5
  • Zinc Finger CCHC Domain-Containing Protein 11 3 4
  • Zinc Finger CCHC-Type Containing 11 2 3
  • Terminal Uridylyltransferase 4 3 4
  • TUTase 4 3 4
  • KIAA0191 2 4
  • ZCCHC11 3 4
  • TENT3A 2 3
  • PAPD3 2 3
  • Zinc Finger, CCHC Domain Containing 11 3
  • PAP Associated Domain Containing 3 3
  • EC 2.7.7.52 4
  • TUTase4 2
  • TUT4 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X