Anti-Mouse PTPRN2 (KIAA0387) Polyclonal Antibody, Rabbit

Product#: MKA0387AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse PTPRN2 (KIAA0387) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0387AF
Quantity 50 µg (250 µL)
Gene :mouse protein tyrosine phosphatase, receptor type, N polypeptide 2 (PTPRN2) (mPTPRN2, mKIAA0387)
Immunogen GX2111 (GST-fusion protein, 192 amino acids)
    IKKSEQPEEVLSSEEETAGVEHVRSRTYSKDLFERKPNSEPQPRRLEDQFQNRAPELWEDEES
    LKLAAQGPPSGGLQLEVQPSEEQQGYILTGNNPLSPEKGKQLMDQVAHILRVPSSFFADIKVLG
    PAVTFKVSANIQNMTTADVIKAAADNKDQLEKATGLTILQSGIRPKGKLKLLPHQEEQEDSTKFI
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX2111. This antibody detects mPTPRN2 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for PTPRN2 Gene

  • Protein Tyrosine Phosphatase Receptor Type N2 2 3 5
  • Phogrin 2 3 4
  • ICAAR 2 3 4
  • Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2 2 3
  • Receptor-Type Tyrosine-Protein Phosphatase N2 3 4
  • Islet Cell Autoantigen-Related Protein 3 4
  • EC 3.1.3.48 4 51
  • IA-2beta 2 3
  • R-PTP-N2 3 4
  • KIAA0387 2 4
  • IAR 3 4
  • IAR/Receptor-Like Protein-Tyrosine Phosphatase 3
  • Protein Tyrosine Phosphatase Receptor Pi 3
  • Tyrosine Phosphatase IA-2 Beta 3
  • EC 3.1.3.- 4
  • IAR PTPRP 2
  • PTPRN2 5
  • PTPRP 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X