Anti-Mouse KLHL29 (KIAA1921) Polyclonal Antibody, Rabbit

Product#: MKA1921AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse KLHL29 (KIAA1921) Polyclonal Antibody, Rabbit


General information 

Cat. No. MKA1921AF
Quantity 50 µg (250 µL)
Gene mouse Kelch-like protein 29 (Kelch repeat and BTB domain-containing protein 9, KLHL29)
   (mKLHL29, mKIAA1921)
Immunogen GX0065 (GST-fusion protein, 278 amino acids)
    TQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLAD
    VWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVERYDTIT
    NQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIES
    PMIDNKYAPAVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLD
    GKIYATGGIVSSEGPALGNMEAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0065. This antibody detects mKLHL29 protein.  
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for KLHL29 Gene

  • Kelch Like Family Member 29 2 3 5
  • Kelch Repeat And BTB Domain-Containing Protein 9 3 4
  • Kelch Repeat And BTB (POZ) Domain Containing 9 2 3
  • Kelch-Like Protein 29 3 4
  • KIAA1921 2 4
  • KBTBD9 3 4
  • Kelch-Like 29 (Drosophila) 2
  • Kelch-Like 29 3
  • KLHL29 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X