Anti-Mouse CLTC (KIAA0034) Polyclonal Antibody, Rabbit

Product#: MKA0034AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse CLTC (KIAA0034) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0034AF
Quantity 50 µg (250 µL)
Gene :mouse Clathrin heavy chain 1 (mCLTC, mKIAA0034)
Immunogen GX0111 (GST-fusion protein, 140 amino acids) 
    EHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASGN
    WEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDA 
    AKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHI 
    VVHADELEELINYYQDRGF
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0111. This antibody detects mCLTC protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for CLTC Gene

  • Clathrin Heavy Chain 2 3 5
  • Clathrin Heavy Chain On Chromosome 17 3 4
  • Clathrin, Heavy Polypeptide-Like 2 2 3
  • Clathrin, Heavy Polypeptide (Hc) 2 3
  • Clathrin Heavy Chain 1 3 4
  • CLH-17 3 4
  • CLTCL2 3 4
  • Hc 2 3
  • Clathrin, Heavy Chain (Hc) 2
  • Clathrin, Heavy Chain 2
  • KIAA0034 4
  • CHC17 3
  • MRD56 3
  • CLH17 4
  • CLTC 5
  • CHC 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X