Anti-Mouse CAMTA2 (KIAA0909) Polyclonal Antibody, Rabbit

Product#: MKA0909AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse CAMTA2 (KIAA0909) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0909AF
Quantity 50 µg (250 µL)
Gene :mouse calmodulin binding transcription activator 2 (CAMTA2), (mCAMTA2, mKIAA0909)
Immunogen GX0828 (GST-fusion protein, 202 amino acids) 
    AAQGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLEAAVLLFCWNRQ
    ALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQELSVEHPLALSPPSSSPDTGLSSASSPSEL 
    SDGTFSVTSAYSSAPDGSPPPAPPLASDISMEMIPGQLSCGAPETPLLLMDYEATNSKEPAPSP 
    CGPPLAQDNGA
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0828. This antibody detects mCAMTA2 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 
MKA0909AF_fig1.png Western blot analysis

Bacterial lysate of MBP-fused antigen
protein (mKIAA0909, partial) 
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for CAMTA2 Gene

  • Calmodulin Binding Transcription Activator 2 2 3 5
  • Calmodulin-Binding Transcription Activator 2 3 4
  • KIAA0909 2 4
  • CAMTA2 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X