Anti-KIAA0338 Rat Homologue Gene Product (Type I Brain 4.1, Protein 4.1N, EPB41L1) Polyclonal Antibody, Rabbit

Product#: PRX-PBR-1002
$577.00
Availability:
Ships in 1-2 weeks

Anti-KIAA0338 Rat Homologue Gene Product (Type I Brain 4.1, Protein 4.1N, EPB41L1) Polyclonal Antibody, Rabbit


General information 

Cat. No. :PRX-PBR-1002
Quantity 100 µg / vial
Gene :rat EPB41L1 (KIAA0338, Type I Brain 4.1, Protein 4.1N)
Immunogen GST-fused KIAA0338 Rat Homologue (260 amino acids: L518-E777)
    LKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKASERAGLREGSEEKVKPPRPRAPESDT
    GDEDQDQERDAVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGGAFEDFSRSLPELD
    RDKSDSETEGLVFARDLKGPSSQEDESGGIEDSPDRGACSTPELPQFESVKAETMTVSSLAIRK
    KIEPEAMLQSRVSTADSTQVDGGAPAAKDFMTTPPCITTETISTTMENSLKSGKGAAAMIPGPQ
    TVATE
Format Rabbit IgG purified with Protein A affinity chromatography.
Constitution :0.01 M Phosphate Buffer (pH 7.4) containing with 0.15 M NaCl and 0.05 % NaN3
Presentation :Lyophilized, reconstitute with 200 µL of distilled water
Antigen Species :Rat
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Rat
Application   :Western blotting (1 : 1,000), ELISA (1 : 1,000), Immunohistochemistry (1 : 25).
    Other applications have not been tested.
Specificity
:This antibody detects rat EPB41L1 protein. Other species have not been tested.
Storage Store at 4°C. For long term storage, make aliquots and store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Yamakawa H. et al., Brain Res Mol Brain Res. (1999) 70(2):197.
  2. Ohara R. et al., Brain Res Dev Brain Res. (1999) 117(2):127.  
 

Aliases for EPB41L1 Gene

  • Erythrocyte Membrane Protein Band 4.1 Like 1 2 3 5
  • 4.1N 2 3 4
  • Band 4.1-Like Protein 1 3 4
  • Neuronal Protein 4.1 3 4
  • KIAA0338 2 4
  • Neuron-Type Nonerythroid Protein 4.1 3
  • EPB41L1 5
  • MRD11 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X